Class a: All alpha proteins [46456] (171 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (2 species) |
Species Thermus thermophilus [TaxId:274] [47067] (18 PDB entries) |
Domain d1g1xb_: 1g1x B: [16393] Other proteins in same PDB: d1g1xa_, d1g1xc_, d1g1xf_, d1g1xh_ |
PDB Entry: 1g1x (more details), 2.6 Å
SCOP Domain Sequences for d1g1xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g1xb_ a.16.1.2 (B:) Ribosomal protein S15 {Thermus thermophilus} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyreiveklglrg
Timeline for d1g1xb_: