Lineage for d1g1xb_ (1g1x B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2004Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
  4. 2005Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 2012Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
  6. 2013Protein Ribosomal protein S15 [47065] (2 species)
  7. 2016Species Thermus thermophilus [TaxId:274] [47067] (10 PDB entries)
  8. 2018Domain d1g1xb_: 1g1x B: [16393]
    Other proteins in same PDB: d1g1xa_, d1g1xc_, d1g1xf_, d1g1xh_

Details for d1g1xb_

PDB Entry: 1g1x (more details), 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

SCOP Domain Sequences for d1g1xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1xb_ a.16.1.2 (B:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyreiveklglrg

SCOP Domain Coordinates for d1g1xb_:

Click to download the PDB-style file with coordinates for d1g1xb_.
(The format of our PDB-style files is described here.)

Timeline for d1g1xb_: