SCOPe 2.08: Domain d1g1xb_: 1g1x B:

Lineage for d1g1xb_ (1g1x B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
   contains additional N-terminal helix that forms a separate unit
   automatically mapped to Pfam PF00312

6. Protein Ribosomal protein S15 [47065] (3 species)

7. Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
   Uniprot P80378

8. Domain d1g1xb_: 1g1x B: [16393]
   Other proteins in same PDB: d1g1xa_, d1g1xc_, d1g1xf_, d1g1xh_

Details for d1g1xb_

PDB Entry: 1g1x, 2.6 Å

PDB Description: structure of ribosomal proteins s15, s6, s18, and 16s ribosomal rna

PDB Compounds: (B:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1g1xb_:

Sequence; same for both SEQRES and ATOM records:

>d1g1xb_ a.16.1.2 (B:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyreiveklglrg

Timeline for d1g1xb_:

• d1g1xb_ first appeared (with stable ids) in SCOP 1.55
  
• d1g1xb_ appears in SCOPe 2.07