Lineage for d2eb0b_ (2eb0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2148530Fold c.107: DHH phosphoesterases [64181] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 6 strands, order 321456
    Domain 2 has mixed sheet of 5 strands, order 12345; strands 1 & 4 are antiparallel to the rest
  4. 2148531Superfamily c.107.1: DHH phosphoesterases [64182] (3 families) (S)
    constituent families have similar domain organization with variable interdomain linker and spatial arrangement of the domains
  5. 2148566Family c.107.1.0: automated matches [191432] (1 protein)
    not a true family
  6. 2148567Protein automated matches [190622] (1 species)
    not a true protein
  7. 2148568Species Methanocaldococcus jannaschii [TaxId:243232] [187657] (1 PDB entry)
  8. 2148570Domain d2eb0b_: 2eb0 B: [163928]
    automated match to d1k23c_
    complexed with mn

Details for d2eb0b_

PDB Entry: 2eb0 (more details), 2.2 Å

PDB Description: Crystal structure of Methanococcus jannaschii putative family II inorganic pyrophosphatase
PDB Compounds: (B:) Manganese-dependent inorganic pyrophosphatase

SCOPe Domain Sequences for d2eb0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eb0b_ c.107.1.0 (B:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mryvvghknpdtdsiasaivlayfldcyparlgdinpetefvlrkfgvmepeliesakgk
eiilvdhseksqsfddleegkliaiidhhkvgltttepilyyakpvgstatviaelyfkd
aidliggkkkelkpdlaglllsaiisdtvlfksptttdldkemakklaeiagisnieefg
meilkaksvvgklkpeeiinmdfknfdfngkkvgigqvevidvseveskkediyklleek
lknegydlivflitdimkegsealvvgnkemfekafnvkvegnsvflegvmsrkkqvvpp
lerayng

SCOPe Domain Coordinates for d2eb0b_:

Click to download the PDB-style file with coordinates for d2eb0b_.
(The format of our PDB-style files is described here.)

Timeline for d2eb0b_: