![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein automated matches [190549] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187654] (1 PDB entry) |
![]() | Domain d2eava_: 2eav A: [163925] automated match to d1sk3a_ complexed with ni |
PDB Entry: 2eav (more details), 2.2 Å
SCOPe Domain Sequences for d2eava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eava_ d.118.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cpgivprsvwgarethcprmtlpakygiiihtagrtcnisdecrllvrdiqsfyidrlks cdigynflvgqdgaiyegvgwnvqgsstpgyddialgitfmgtftgippnaaaleaaqdl iqcamvkgyltpnyllvghsdvartlspgqalyniistwphfkh
Timeline for d2eava_: