Class a: All alpha proteins [46456] (202 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit |
Protein Ribosomal protein S15 [47065] (2 species) |
Species Thermus thermophilus [TaxId:274] [47067] (19 PDB entries) |
Domain d1hnxo_: 1hnx O: [16392] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxd_, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ complexed with mg, pcy, zn |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxo_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1hnxo_: