Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (20 species) not a true protein |
Species Cellulomonas bogoriensis [TaxId:301388] [187656] (1 PDB entry) |
Domain d2ea3a_: 2ea3 A: [163919] automated match to d2sfaa_ complexed with so4 |
PDB Entry: 2ea3 (more details), 1.78 Å
SCOPe Domain Sequences for d2ea3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ea3a_ b.47.1.0 (A:) automated matches {Cellulomonas bogoriensis [TaxId: 301388]} fdviggnaytiggrsrcsigfavnggfitaghcgrtgattanptgtfagssfpgndyafv rtgagvnllaqvnnysggrvqvaghtaapvgsavcrsgsttgwhcgtitalnssvtypeg tvrglirttvcaepgdsggsllagnqaqgvtsggsgncrtggttffqpvnpilqayglrm itt
Timeline for d2ea3a_: