Class a: All alpha proteins [46456] (290 folds) |
Fold a.127: L-aspartase-like [48556] (1 superfamily) multihelical, consists of three all-alpha domains |
Superfamily a.127.1: L-aspartase-like [48557] (3 families) |
Family a.127.1.0: automated matches [191431] (1 protein) not a true family |
Protein automated matches [190621] (30 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [187653] (1 PDB entry) |
Domain d2e9fc_: 2e9f C: [163914] automated match to d1tj7a_ complexed with arg |
PDB Entry: 2e9f (more details), 2.8 Å
SCOPe Domain Sequences for d2e9fc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e9fc_ a.127.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} pdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeiea gtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellall lalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledakerl nesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhls rmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsavv kglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlatel adylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrleta ihrrrsyggtapeavrerleeakkevgl
Timeline for d2e9fc_: