Lineage for d2e9fc_ (2e9f C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010426Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2010427Protein automated matches [190621] (20 species)
    not a true protein
  7. 2010542Species Thermus thermophilus HB8 [TaxId:300852] [187653] (1 PDB entry)
  8. 2010545Domain d2e9fc_: 2e9f C: [163914]
    automated match to d1tj7a_
    complexed with arg

Details for d2e9fc_

PDB Entry: 2e9f (more details), 2.8 Å

PDB Description: crystal structure of t.th.hb8 argininosuccinate lyase complexed with l-arginine
PDB Compounds: (C:) Argininosuccinate Lyase

SCOPe Domain Sequences for d2e9fc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e9fc_ a.127.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pdalaarfnaslafdralwredlwqnrvharmlhavgllsaeeleailkgldrieeeiea
gtfpwreeledvhmnlearltelvgppggklhtarsrndqvatdlrlylrgaidellall
lalrrvlvreaekhldplyvlpgythlqraqpvllahwflayyemlkrdagrledakerl
nesplgaaalagtgfpidrhftarelgfkapmrnsldavasrdfalevlsalnigmlhls
rmaeelilysteefgfvevpdafatgssimpqkknpdilelirakagrvlgafvglsavv
kglplaynkdlqedkeplldalatyrdslrllaallpglkwrrermwraaeggytlatel
adylaekglpfreahhvvgrlvrrlveegralkdltleelqahhplfaedalpllrleta
ihrrrsyggtapeavrerleeakkevgl

SCOPe Domain Coordinates for d2e9fc_:

Click to download the PDB-style file with coordinates for d2e9fc_.
(The format of our PDB-style files is described here.)

Timeline for d2e9fc_: