Class b: All beta proteins [48724] (177 folds) |
Fold b.45: Split barrel-like [50474] (3 superfamilies) barrel; n=6, S=10; greek-key |
Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) related to the ferredoxin reductase-like FAD-binding domain |
Family b.45.1.1: PNP-oxidase like [50476] (17 proteins) |
Protein FMN-binding protein [50477] (1 species) |
Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (11 PDB entries) |
Domain d2e83b_: 2e83 B: [163901] automated match to d1axja_ complexed with fmn; mutant |
PDB Entry: 2e83 (more details), 1.52 Å
SCOPe Domain Sequences for d2e83b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e83b_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]} mlpgtffevlknegvvaiatqgedgphlvnvwnsylkvldgnrivvpvggmhkteanvar dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq tl
Timeline for d2e83b_: