Lineage for d2e83b_ (2e83 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1317892Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 1317893Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 1317894Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 1317901Protein FMN-binding protein [50477] (1 species)
  7. 1317902Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (10 PDB entries)
  8. 1317912Domain d2e83b_: 2e83 B: [163901]
    automated match to d1axja_
    complexed with fmn; mutant

Details for d2e83b_

PDB Entry: 2e83 (more details), 1.52 Å

PDB Description: t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f)
PDB Compounds: (B:) fmn-binding protein

SCOPe Domain Sequences for d2e83b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e83b_ b.45.1.1 (B:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvnvwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOPe Domain Coordinates for d2e83b_:

Click to download the PDB-style file with coordinates for d2e83b_.
(The format of our PDB-style files is described here.)

Timeline for d2e83b_: