Lineage for d2e83a_ (2e83 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2403705Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2403706Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2403707Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2403714Protein FMN-binding protein [50477] (1 species)
  7. 2403715Species Desulfovibrio vulgaris, strain Miyazaki F [TaxId:881] [50478] (11 PDB entries)
  8. 2403724Domain d2e83a_: 2e83 A: [163900]
    automated match to d1axja_
    complexed with fmn; mutant

Details for d2e83a_

PDB Entry: 2e83 (more details), 1.52 Å

PDB Description: t31v mutant of fmn-binding protein from desulfovibrio vulgaris (miyazaki f)
PDB Compounds: (A:) fmn-binding protein

SCOPe Domain Sequences for d2e83a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e83a_ b.45.1.1 (A:) FMN-binding protein {Desulfovibrio vulgaris, strain Miyazaki F [TaxId: 881]}
mlpgtffevlknegvvaiatqgedgphlvnvwnsylkvldgnrivvpvggmhkteanvar
dervlmtlgsrkvagrngpgtgflirgsaafrtdgpefeaiarfkwaraalvitvvsaeq
tl

SCOPe Domain Coordinates for d2e83a_:

Click to download the PDB-style file with coordinates for d2e83a_.
(The format of our PDB-style files is described here.)

Timeline for d2e83a_: