Lineage for d1hnzo_ (1hnz O:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 534943Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 534944Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 534951Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 534952Protein Ribosomal protein S15 [47065] (2 species)
  7. 534955Species Thermus thermophilus [TaxId:274] [47067] (23 PDB entries)
  8. 534966Domain d1hnzo_: 1hnz O: [16390]
    Other proteins in same PDB: d1hnzb_, d1hnzc1, d1hnzc2, d1hnzd_, d1hnze1, d1hnze2, d1hnzf_, d1hnzg_, d1hnzh_, d1hnzi_, d1hnzj_, d1hnzk_, d1hnzl_, d1hnzm_, d1hnzn_, d1hnzp_, d1hnzq_, d1hnzr_, d1hnzs_, d1hnzt_, d1hnzv_
    complexed with hyg, mg, zn

Details for d1hnzo_

PDB Entry: 1hnz (more details), 3.3 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b

SCOP Domain Sequences for d1hnzo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnzo_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1hnzo_:

Click to download the PDB-style file with coordinates for d1hnzo_.
(The format of our PDB-style files is described here.)

Timeline for d1hnzo_: