Lineage for d2e7la_ (2e7l A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 931683Protein automated matches [190119] (11 species)
    not a true protein
  7. 931803Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)
  8. 931828Domain d2e7la_: 2e7l A: [163893]
    automated match to d1i9ea_
    mutant

Details for d2e7la_

PDB Entry: 2e7l (more details), 2.5 Å

PDB Description: Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9
PDB Compounds: (A:) Cytotoxic Tcell receptor

SCOPe Domain Sequences for d2e7la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e7la_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlpy

SCOPe Domain Coordinates for d2e7la_:

Click to download the PDB-style file with coordinates for d2e7la_.
(The format of our PDB-style files is described here.)

Timeline for d2e7la_: