SCOPe 2.01: Domain d2e7la_: 2e7l A:

Lineage for d2e7la_ (2e7l A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (22 PDB entries)

8. Domain d2e7la_: 2e7l A: [163893]
   automated match to d1i9ea_
   mutant

Details for d2e7la_

PDB Entry: 2e7l, 2.5 Å

PDB Description: Structure of a high-affinity mutant of the 2C TCR in complex with Ld/QL9

PDB Compounds: (A:) Cytotoxic Tcell receptor

SCOPe Domain Sequences for d2e7la_:

Sequence; same for both SEQRES and ATOM records:

>d2e7la_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsvtqpdarvtvsegaslqlrckysysatpylfwyvqyprqgpqlllkyysgdpvvqgvn
gfeaefsksnssfhlrkasvhrsdsavyfcavshqgryltfgsgtkvivlpy

Timeline for d2e7la_:

• d2e7la_ is new in SCOPe 2.01-stable
  
• d2e7la_ appears in SCOPe 2.02
  
• d2e7la_ appears in the current release, SCOPe 2.08