![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) ![]() |
![]() | Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 proteins) |
![]() | Protein automated matches [190620] (2 species) not a true protein |
![]() | Species Moorella thermoacetica [TaxId:1525] [187652] (4 PDB entries) |
![]() | Domain d2e7fb_: 2e7f B: [163892] automated match to d1f6ya_ complexed with c2f, ca |
PDB Entry: 2e7f (more details), 2.2 Å
SCOPe Domain Sequences for d2e7fb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7fb_ c.1.21.2 (B:) automated matches {Moorella thermoacetica [TaxId: 1525]} mliigeringmfgdikraiqerdpapvqewarrqeeggaraldlnvgpavqdkvsamewl vevtqevsnltlcldstnikaieaglkkcknraminstnaerekveklfplavehgaali gltmnktgipkdsdtrlafamelvaaadefglpmedlyidplilpanvaqdhapevlktl qqikmladpapktvlglsnvsqncqnrplinrtflamamacgldaaiadacdealietaa taeillnqtvycdsfvkmfktr
Timeline for d2e7fb_: