![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein) contains additional N-terminal helix that forms a separate unit automatically mapped to Pfam PF00312 |
![]() | Protein Ribosomal protein S15 [47065] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries) Uniprot P80378 |
![]() | Domain d1hr0o_: 1hr0 O: [16389] Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_ complexed with mg, zn |
PDB Entry: 1hr0 (more details), 3.2 Å
SCOPe Domain Sequences for d1hr0o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hr0o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]} pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg qrrrllrylqredperyralieklgirg
Timeline for d1hr0o_: