Lineage for d1hr0o_ (1hr0 O:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637242Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 637243Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 637252Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 637253Protein Ribosomal protein S15 [47065] (2 species)
  7. 637256Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
  8. 637266Domain d1hr0o_: 1hr0 O: [16389]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_
    complexed with mg, zn

Details for d1hr0o_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d1hr0o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1hr0o_:

Click to download the PDB-style file with coordinates for d1hr0o_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0o_: