SCOPe 2.04: Domain d2e6gd_: 2e6g D:

Lineage for d2e6gd_ (2e6g D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187651] (6 PDB entries)

8. Domain d2e6gd_: 2e6g D: [163871]
   automated match to d1ilva_
   complexed with po4

Details for d2e6gd_

PDB Entry: 2e6g, 2.6 Å

PDB Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with phosphate

PDB Compounds: (D:) 5'-nucleotidase sure

SCOPe Domain Sequences for d2e6gd_:

Sequence, based on SEQRES records:

>d2e6gd_ c.106.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl

Sequence, based on observed residues (ATOM records):

>d2e6gd_ c.106.1.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapditiahpvrayphpsplhaphfpayr
vrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsv
plngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipg
edpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrl

Timeline for d2e6gd_:

• d2e6gd_ first appeared in SCOPe 2.01
  
• d2e6gd_ appears in SCOPe 2.03
  
• d2e6gd_ appears in SCOPe 2.05
  
• d2e6gd_ appears in the current release, SCOPe 2.08