SCOPe 2.06: Domain d2e69b_: 2e69 B:

Lineage for d2e69b_ (2e69 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.106: SurE-like [64166] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7

4. Superfamily c.106.1: SurE-like [64167] (2 families)
   some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family

5. Family c.106.1.0: automated matches [191430] (1 protein)
   not a true family

6. Protein automated matches [190619] (7 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187651] (6 PDB entries)

8. Domain d2e69b_: 2e69 B: [163847]
   automated match to d1ilva_
   complexed with gol, so4

Details for d2e69b_

PDB Entry: 2e69, 2.2 Å

PDB Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with sulfate

PDB Compounds: (B:) 5'-nucleotidase sure

SCOPe Domain Sequences for d2e69b_:

Sequence, based on SEQRES records:

>d2e69b_ c.106.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
la

Sequence, based on observed residues (ATOM records):

>d2e69b_ c.106.1.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdhaitiahpvrayphpspphfpayrv
rgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvp
lngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipge
dpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptla

Timeline for d2e69b_:

• d2e69b_ first appeared in SCOPe 2.01
  
• d2e69b_ appears in SCOPe 2.05
  
• d2e69b_ appears in SCOPe 2.07
  
• d2e69b_ appears in the current release, SCOPe 2.08