Lineage for d2e69b_ (2e69 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010642Fold c.106: SurE-like [64166] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 9 strands, order 342156798; strands 3, 8 and 9 are antiparallel to the rest; left-handed crossover connection between strands 6 and 7
  4. 1010643Superfamily c.106.1: SurE-like [64167] (2 families) (S)
    some topological similarity to the N-terminal domain of Glutaminase/Asparaginase family
  5. 1010659Family c.106.1.0: automated matches [191430] (1 protein)
    not a true family
  6. 1010660Protein automated matches [190619] (3 species)
    not a true protein
  7. 1010667Species Thermus thermophilus [TaxId:300852] [187651] (6 PDB entries)
  8. 1010677Domain d2e69b_: 2e69 B: [163847]
    automated match to d1ilva_
    complexed with gol, so4

Details for d2e69b_

PDB Entry: 2e69 (more details), 2.2 Å

PDB Description: Crystal structure of the stationary phase survival protein SurE from Thermus thermophilus HB8 in complex with sulfate
PDB Compounds: (B:) 5'-nucleotidase sure

SCOPe Domain Sequences for d2e69b_:

Sequence, based on SEQRES records: (download)

>d2e69b_ c.106.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdteqsaaghaitiahpvrayphpspl
haphfpayrvrgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylf
glsaaafsvplngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvr
ayegvvipgedpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqpt
la

Sequence, based on observed residues (ATOM records): (download)

>d2e69b_ c.106.1.0 (B:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrilvtnddgiyspglwalaeaasqfgevfvaapdhaitiahpvrayphpspphfpayrv
rgtpadcvalglhlfgpvdlvlsgvnlgsnlgheiwhsgtvaaakqgylfglsaaafsvp
lngevpdfaglrpwllrtletllrlerpflvnvnlplrpkgflwtrqsvrayegvvipge
dpmgrpfywfaprplkeaeegtdrwavaqgfvsatplrldltdetrlqptla

SCOPe Domain Coordinates for d2e69b_:

Click to download the PDB-style file with coordinates for d2e69b_.
(The format of our PDB-style files is described here.)

Timeline for d2e69b_: