Lineage for d2e66b_ (2e66 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027295Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1027404Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)
  6. 1027405Protein Cut A1 [89931] (5 species)
  7. 1027427Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries)
    Uniprot O58720
  8. 1027444Domain d2e66b_: 2e66 B: [163842]
    automated match to d1ukua_
    complexed with cl, na; mutant

Details for d2e66b_

PDB Entry: 2e66 (more details), 2 Å

PDB Description: crystal structure of cuta1 from pyrococcus horikoshii ot3, mutation d60a
PDB Compounds: (B:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d2e66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e66b_ d.58.5.2 (B:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktrea
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

SCOPe Domain Coordinates for d2e66b_:

Click to download the PDB-style file with coordinates for d2e66b_.
(The format of our PDB-style files is described here.)

Timeline for d2e66b_: