Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins) |
Protein Cut A1 [89931] (5 species) |
Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries) Uniprot O58720 |
Domain d2e66b_: 2e66 B: [163842] automated match to d1ukua_ complexed with cl, na; mutant |
PDB Entry: 2e66 (more details), 2 Å
SCOPe Domain Sequences for d2e66b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e66b_ d.58.5.2 (B:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]} miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktrea lweelkerikelhpydvpaiiridvddvnedylkwlieetkk
Timeline for d2e66b_: