SCOPe 2.08: Domain d2e5xa_: 2e5x A:

Lineage for d2e5xa_ (2e5x A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein XTP pyrophosphatase [52974] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102470] (7 PDB entries)
   PH1917

8. Domain d2e5xa_: 2e5x A: [163840]
   automated match to d1v7ra_
   complexed with edo, itt, na

Details for d2e5xa_

PDB Entry: 2e5x, 2 Å

PDB Description: structure of nucleotide triphosphate pyrophosphatase from pyrococcus horikoshii ot3

PDB Compounds: (A:) Hypothetical protein PH1917

SCOPe Domain Sequences for d2e5xa_:

Sequence; same for both SEQRES and ATOM records:

>d2e5xa_ c.51.4.1 (A:) XTP pyrophosphatase {Pyrococcus horikoshii [TaxId: 53953]}
mkiffitsnpgkvrevanflgtfgieivqlkheypeiqaekledvvdfgiswlkgkvpep
fmiedsglfieslkgfpgvyssyvyrtiglegilklmegaedrrayfksvigfyidgkay
kfsgvtwgrisnekrgthgfgydpifipegsqktfaemtieeknalshrgkalkaffewl
kvnlk

Timeline for d2e5xa_:

• d2e5xa_ first appeared in SCOPe 2.01
  
• d2e5xa_ appears in SCOPe 2.07