Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) |
Family c.66.1.17: Spermidine synthase [69557] (3 proteins) contains additional N-terminal tetramerisation all-beta domain, res. 1-71 |
Protein automated matches [190432] (5 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:70601] [187326] (1 PDB entry) |
Domain d2e5wb_: 2e5w B: [163837] automated match to d1mjfa_ complexed with act, ag3, mta |
PDB Entry: 2e5w (more details), 2 Å
SCOPe Domain Sequences for d2e5wb_:
Sequence, based on SEQRES records: (download)
>d2e5wb_ c.66.1.17 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyh eplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigid ggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefyknayr alndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgsi dfmkvdaekgkklgleyydpdkhetlfqmpryivqml
>d2e5wb_ c.66.1.17 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]} mefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyh eplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyigid ggilekmlsdkhekgkliigdgvkfieensgfdviivdsmlfseefyknayralndpgiy vtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvkgsidfmkvdae kgkklgleyydpdkhetlfqmpryivqml
Timeline for d2e5wb_: