Lineage for d2e5wa_ (2e5w A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864482Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1864483Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1864900Family c.66.1.17: Spermidine synthase [69557] (3 proteins)
    contains additional N-terminal tetramerisation all-beta domain, res. 1-71
  6. 1864943Protein automated matches [190432] (5 species)
    not a true protein
  7. 1864956Species Pyrococcus horikoshii [TaxId:70601] [187326] (1 PDB entry)
  8. 1864957Domain d2e5wa_: 2e5w A: [163836]
    automated match to d1mjfa_
    complexed with act, ag3, mta

Details for d2e5wa_

PDB Entry: 2e5w (more details), 2 Å

PDB Description: Crystal structure of spermidine synthase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) Probable spermidine synthase

SCOPe Domain Sequences for d2e5wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e5wa_ c.66.1.17 (A:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrdmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegek
syheplvhpamlahpnprrvliigggdggairevlkheeveevimveidkkvieisakyi
gidggilekmlsdkhekgkliigdgvkfieensgfdviivdstdpvgpaemlfseefykn
ayralndpgiyvtqagsvylftdefltayrkmrkvfdkvyyysfpvigyaspwaflvgvk
gsidfmkvdaekgkklgleyydpdkhetlfqmpryivqml

SCOPe Domain Coordinates for d2e5wa_:

Click to download the PDB-style file with coordinates for d2e5wa_.
(The format of our PDB-style files is described here.)

Timeline for d2e5wa_: