Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (32 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [188297] (1 PDB entry) |
Domain d2e55c_: 2e55 C: [163832] automated match to d1o5oa_ complexed with so4 |
PDB Entry: 2e55 (more details), 2.15 Å
SCOPe Domain Sequences for d2e55c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e55c_ c.61.1.0 (C:) automated matches {Aquifex aeolicus [TaxId: 63363]} mivelshplikhkvntariqdtsaeklrktlkelgfmlvyealkdilleekevrtwignk rfnylneeeivfvpilraglsflegalqvvpnakvgflgikrneetleshiyysrlpelk gkivvildpmlatggtlevalreilkhsplkvksvhaiaapeglkrieekfkeveifvgn vderlndkgyiipglgdigdrlyavsvy
Timeline for d2e55c_: