SCOPe 2.08: Domain d2e4qc_: 2e4q C:

Lineage for d2e4qc_ (2e4q C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries)

8. Domain d2e4qc_: 2e4q C: [163827]
   automated match to d1fqta_
   complexed with fes

Details for d2e4qc_

PDB Entry: 2e4q, 1.8 Å

PDB Description: Crystal structure of BphA3 (reduced form)

PDB Compounds: (C:) Biphenyl dioxygenase ferredoxin subunit

SCOPe Domain Sequences for d2e4qc_:

Sequence; same for both SEQRES and ATOM records:

>d2e4qc_ b.33.1.1 (C:) automated matches {Pseudomonas sp. [TaxId: 306]}
tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalh

Timeline for d2e4qc_:

• d2e4qc_ first appeared in SCOPe 2.01
  
• d2e4qc_ appears in SCOPe 2.07