SCOPe 2.05: Domain d2e4pa_: 2e4p A:

Lineage for d2e4pa_ (2e4p A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Pseudomonas sp. [TaxId:306] [188227] (3 PDB entries)

8. Domain d2e4pa_: 2e4p A: [163824]
   automated match to d1fqta_
   complexed with fes, so4, tre

Details for d2e4pa_

PDB Entry: 2e4p, 2 Å

PDB Description: crystal structure of bpha3 (oxidized form)

PDB Compounds: (A:) Biphenyl dioxygenase ferredoxin subunit

SCOPe Domain Sequences for d2e4pa_:

Sequence; same for both SEQRES and ATOM records:

>d2e4pa_ b.33.1.1 (A:) automated matches {Pseudomonas sp. [TaxId: 306]}
tftkacsvdevppgealqvshdaqkvaifnvdgeffatqdqcthgewslseggyldgdvv
ecslhmgkfcvrtgkvkspppceplkvypiriegrdvlvdfsraalha

Timeline for d2e4pa_:

• d2e4pa_ first appeared in SCOPe 2.01
  
• d2e4pa_ appears in SCOPe 2.04
  
• d2e4pa_ appears in SCOPe 2.06
  
• d2e4pa_ appears in the current release, SCOPe 2.08