Lineage for d1ns1a_ (1ns1 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311088Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (3 species)
  7. 2311089Species Influenza A virus, different strains [TaxId:11320] [47063] (2 PDB entries)
  8. 2311091Domain d1ns1a_: 1ns1 A: [16382]

Details for d1ns1a_

PDB Entry: 1ns1 (more details)

PDB Description: rna-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d1ns1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ns1a_ a.16.1.1 (A:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus, different strains [TaxId: 11320]}
mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
gkqivekilkees

SCOPe Domain Coordinates for d1ns1a_:

Click to download the PDB-style file with coordinates for d1ns1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ns1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ns1b_