Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) consists of one domain of this fold |
Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
Protein BH0863-like Ribonuclease H [142490] (3 species) new class of RNase H |
Species Shewanella oneidensis [TaxId:211586] [190023] (1 PDB entry) |
Domain d2e4la_: 2e4l A: [163817] automated match to d1rbra_ |
PDB Entry: 2e4l (more details), 2 Å
SCOPe Domain Sequences for d2e4la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e4la_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Shewanella oneidensis [TaxId: 211586]} lklihiftdgsclgnpgpggygivmnykghtkemsdgfslttnnrmellapivalealke pckiiltsdsqymrqgimtwihgwkkkgwmtsnrtpvknvdlwkrldkaaqlhqidwrwv kghaghaenercdqlaraaaeanptqidtgyqaes
Timeline for d2e4la_: