Lineage for d2e4la_ (2e4l A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493669Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2493670Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 2493703Species Shewanella oneidensis [TaxId:211586] [190023] (1 PDB entry)
  8. 2493704Domain d2e4la_: 2e4l A: [163817]
    automated match to d1rbra_

Details for d2e4la_

PDB Entry: 2e4l (more details), 2 Å

PDB Description: Thermodynamic and Structural Analysis of Thermolabile RNase HI from Shewanella oneidensis MR-1
PDB Compounds: (A:) ribonuclease hi

SCOPe Domain Sequences for d2e4la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e4la_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Shewanella oneidensis [TaxId: 211586]}
lklihiftdgsclgnpgpggygivmnykghtkemsdgfslttnnrmellapivalealke
pckiiltsdsqymrqgimtwihgwkkkgwmtsnrtpvknvdlwkrldkaaqlhqidwrwv
kghaghaenercdqlaraaaeanptqidtgyqaes

SCOPe Domain Coordinates for d2e4la_:

Click to download the PDB-style file with coordinates for d2e4la_.
(The format of our PDB-style files is described here.)

Timeline for d2e4la_: