Lineage for d2e4fa_ (2e4f A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765908Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins)
  6. 2765926Protein automated matches [190782] (2 species)
    not a true protein
  7. 2765934Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries)
  8. 2765943Domain d2e4fa_: 2e4f A: [163816]
    automated match to d1n9pa_

Details for d2e4fa_

PDB Entry: 2e4f (more details), 2.3 Å

PDB Description: crystal structure of the cytoplasmic domain of g-protein-gated inward rectifier potassium channel kir3.2
PDB Compounds: (A:) G protein-activated inward rectifier potassium channel 2

SCOPe Domain Sequences for d2e4fa_:

Sequence, based on SEQRES records: (download)

>d2e4fa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshiveasi
raklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaql
pkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhet
yetstpslsakelaelanrae

Sequence, based on observed residues (ATOM records): (download)

>d2e4fa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqryvrkdgkcnvhhgnaetlvfsthavismrdgklclmfrvgdlriveasirakliksk
qtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpkeeleiv
vilegmveatgmtcqarssyitseilwgyrftpvltlgfyevdynsfhetyetstpslsa
kelaelanrae

SCOPe Domain Coordinates for d2e4fa_:

Click to download the PDB-style file with coordinates for d2e4fa_.
(The format of our PDB-style files is described here.)

Timeline for d2e4fa_: