Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 proteins) |
Protein automated matches [190782] (2 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188028] (10 PDB entries) |
Domain d2e4fa_: 2e4f A: [163816] automated match to d1n9pa_ |
PDB Entry: 2e4f (more details), 2.3 Å
SCOPe Domain Sequences for d2e4fa_:
Sequence, based on SEQRES records: (download)
>d2e4fa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqryvrkdgkcnvhhgnvrekraetlvfsthavismrdgklclmfrvgdlrnshiveasi raklikskqtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaql pkeeleivvilegmveatgmtcqarssyitseilwgyrftpvltledgfyevdynsfhet yetstpslsakelaelanrae
>d2e4fa_ b.1.18.16 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqryvrkdgkcnvhhgnaetlvfsthavismrdgklclmfrvgdlriveasirakliksk qtsegefiplnqtdinvgyytgddrlflvspliisheinqqspfweiskaqlpkeeleiv vilegmveatgmtcqarssyitseilwgyrftpvltlgfyevdynsfhetyetstpslsa kelaelanrae
Timeline for d2e4fa_: