Lineage for d2e47b_ (2e47 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764499Species Silkworm (Bombyx mori) [TaxId:7091] [188296] (2 PDB entries)
  8. 2764501Domain d2e47b_: 2e47 B: [163815]
    automated match to d1srda_
    complexed with cu, zn

Details for d2e47b_

PDB Entry: 2e47 (more details), 2.11 Å

PDB Description: crystal structure analysis of the clock protein ea4 (glycosylation form)
PDB Compounds: (B:) Time interval measuring enzyme TIME

SCOPe Domain Sequences for d2e47b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e47b_ b.1.8.0 (B:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
ttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsggclst
gshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigravvlh
ekaddygksdhpdsrktgnaggrvacgvigil

SCOPe Domain Coordinates for d2e47b_:

Click to download the PDB-style file with coordinates for d2e47b_.
(The format of our PDB-style files is described here.)

Timeline for d2e47b_: