SCOPe 2.05: Domain d2e47a_: 2e47 A:

Lineage for d2e47a_ (2e47 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.0: automated matches [191527] (1 protein)
   not a true family

6. Protein automated matches [190890] (5 species)
   not a true protein

7. Species Silkworm (Bombyx mori) [TaxId:7091] [188296] (2 PDB entries)

8. Domain d2e47a_: 2e47 A: [163814]
   automated match to d1srda_
   complexed with cu, zn

Details for d2e47a_

PDB Entry: 2e47, 2.11 Å

PDB Description: crystal structure analysis of the clock protein ea4 (glycosylation form)

PDB Compounds: (A:) Time interval measuring enzyme TIME

SCOPe Domain Sequences for d2e47a_:

Sequence; same for both SEQRES and ATOM records:

>d2e47a_ b.1.8.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
hgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsggc
lstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigrav
vlhekaddygksdhpdsrktgnaggrvacgvigil

Timeline for d2e47a_:

• d2e47a_ first appeared in SCOPe 2.01
  
• d2e47a_ appears in SCOPe 2.04
  
• d2e47a_ appears in SCOPe 2.06
  
• d2e47a_ appears in the current release, SCOPe 2.08