![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [188296] (2 PDB entries) |
![]() | Domain d2e47a_: 2e47 A: [163814] automated match to d1srda_ complexed with cu, zn |
PDB Entry: 2e47 (more details), 2.11 Å
SCOPe Domain Sequences for d2e47a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e47a_ b.1.8.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]} hgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsggc lstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigrav vlhekaddygksdhpdsrktgnaggrvacgvigil
Timeline for d2e47a_: