Lineage for d2e46a_ (2e46 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764499Species Silkworm (Bombyx mori) [TaxId:7091] [188296] (2 PDB entries)
  8. 2764502Domain d2e46a_: 2e46 A: [163813]
    automated match to d1srda_
    complexed with cu, zn

Details for d2e46a_

PDB Entry: 2e46 (more details), 2.3 Å

PDB Description: Crystal Structure Analysis of the clock protein EA4
PDB Compounds: (A:) Time interval measuring enzyme TIME

SCOPe Domain Sequences for d2e46a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e46a_ b.1.8.0 (A:) automated matches {Silkworm (Bombyx mori) [TaxId: 7091]}
mhhgfttpsraiavlstetirgnitftqvqdgkvhvqggitglppgeygfhvhekgdlsg
gclstgshfnpehkdhghpndvnrhvgdlgnvvfdenhysridlvddqislsgphgiigr
avvlhekaddygksdhpdsrktgnaggrvacgvigil

SCOPe Domain Coordinates for d2e46a_:

Click to download the PDB-style file with coordinates for d2e46a_.
(The format of our PDB-style files is described here.)

Timeline for d2e46a_: