Lineage for d2e3xc_ (2e3x C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1048063Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1048064Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1048685Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1048686Protein automated matches [190159] (5 species)
    not a true protein
  7. 1048696Species Daboia russellii [TaxId:343250] [188295] (1 PDB entry)
  8. 1048698Domain d2e3xc_: 2e3x C: [163812]
    automated match to d1iodb_
    complexed with ca, gm6, nag, zn

Details for d2e3xc_

PDB Entry: 2e3x (more details), 2.91 Å

PDB Description: crystal structure of russell's viper venom metalloproteinase
PDB Compounds: (C:) Coagulation factor X-activating enzyme light chain 1

SCOPe Domain Sequences for d2e3xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3xc_ d.169.1.0 (C:) automated matches {Daboia russellii [TaxId: 343250]}
dcpsgwlsyeqhcykgfndlknwtdaekfcteqkkgshlvslhsreeekfvvnlisenle
ypatwiglgnmwkdcrmewsdrgnvkykalaeesyclimithekvwksmtcnfiapvvck

SCOPe Domain Coordinates for d2e3xc_:

Click to download the PDB-style file with coordinates for d2e3xc_.
(The format of our PDB-style files is described here.)

Timeline for d2e3xc_: