SCOPe 2.03: Domain d2e3xb_: 2e3x B:

Lineage for d2e3xb_ (2e3x B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Daboia russellii [TaxId:343250] [188295] (1 PDB entry)

8. Domain d2e3xb_: 2e3x B: [163811]
   automated match to d1bj3a_
   complexed with ca, gm6, nag, zn

Details for d2e3xb_

PDB Entry: 2e3x, 2.91 Å

PDB Description: crystal structure of russell's viper venom metalloproteinase

PDB Compounds: (B:) Coagulation factor X-activating enzyme light chain 2

SCOPe Domain Sequences for d2e3xb_:

Sequence, based on SEQRES records:

>d2e3xb_ d.169.1.0 (B:) automated matches {Daboia russellii [TaxId: 343250]}
dcppdsslyryfcyrvfkehktweaaerfcmehpnnghlvsiesmeeaefvakllsnttg
kfithfwiglmikdkeqecssewsdgssvsydklgkqefrkcfvlekesgyrmwfnrnce
erylfvckvppec

Sequence, based on observed residues (ATOM records):

>d2e3xb_ d.169.1.0 (B:) automated matches {Daboia russellii [TaxId: 343250]}
dcppdsslyryfcyrvfkehktweaaerfcmehpnnghlvsiesmeeaefvakllsnttt
hfwiglmikdkeqecssewsdgssvsydklgkqefrkcfvlekesgyrmwfnrnceeryl
fvckvppec

Timeline for d2e3xb_:

• d2e3xb_ first appeared in SCOPe 2.01
  
• d2e3xb_ appears in SCOPe 2.02
  
• d2e3xb_ appears in SCOPe 2.04
  
• d2e3xb_ appears in the current release, SCOPe 2.08