Lineage for d2e3vc1 (2e3v C:10-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2761681Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2761682Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2762066Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 2762067Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
    Uniprot P13592 498-598
  8. 2762071Domain d2e3vc1: 2e3v C:10-108 [163810]
    Other proteins in same PDB: d2e3va2, d2e3vb2, d2e3vc2
    automated match to d2haza1
    complexed with btb, edo, peg, pge

Details for d2e3vc1

PDB Entry: 2e3v (more details), 1.95 Å

PDB Description: Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4
PDB Compounds: (C:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOPe Domain Sequences for d2e3vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e3vc1 b.1.2.1 (C:10-108) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
psspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasmeg
ivtivglkpettyavrlaalngkglgeisaasefktqpv

SCOPe Domain Coordinates for d2e3vc1:

Click to download the PDB-style file with coordinates for d2e3vc1.
(The format of our PDB-style files is described here.)

Timeline for d2e3vc1: