Lineage for d1ail__ (1ail -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) 
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (1 protein) Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (1 species) Species Influenza A virus [TaxId:11320] [47063] (2 PDB entries) 
Domain d1ail__: 1ail - [16381]
Details for d1ail__
PDB Entry: 1ail (more details), 1.9 Å
PDB Description: n-terminal fragment of ns1 protein from influenza a virus
SCOP Domain Sequences for d1ail__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ail__ a.16.1.1 (-) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus}
mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
gkqivekilk
SCOP Domain Coordinates for d1ail__:
Click to download the PDB-style file with coordinates for d1ail__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ail__:
- d1ail__ appears in SCOP 1.57
- d1ail__ appears in the current release, SCOPe 2.08, called d1aila_
View in 3D