Lineage for d2e3va_ (2e3v A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 936085Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 936086Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
    Uniprot P13592 498-598
  8. 936088Domain d2e3va_: 2e3v A: [163808]
    automated match to d2haza1
    complexed with btb, edo, peg, pge

Details for d2e3va_

PDB Entry: 2e3v (more details), 1.95 Å

PDB Description: Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4
PDB Compounds: (A:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOPe Domain Sequences for d2e3va_:

Sequence, based on SEQRES records: (download)

>d2e3va_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
sgpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpvreps

Sequence, based on observed residues (ATOM records): (download)

>d2e3va_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
sgpsspsidqvepysstaqvqfdepeatvpilkykaewravgeevwhskwydakeasmeg
ivtivglkpettyavrlaalngkglgeisaasefktqpvreps

SCOPe Domain Coordinates for d2e3va_:

Click to download the PDB-style file with coordinates for d2e3va_.
(The format of our PDB-style files is described here.)

Timeline for d2e3va_: