SCOPe 2.01: Domain d2e3va_: 2e3v A:

Lineage for d2e3va_ (2e3v A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries)
   Uniprot P13592 498-598

8. Domain d2e3va_: 2e3v A: [163808]
   automated match to d2haza1
   complexed with btb, edo, peg, pge

Details for d2e3va_

PDB Entry: 2e3v, 1.95 Å

PDB Description: Crystal structure of the first fibronectin type III domain of neural cell adhesion molecule splicing isoform from human muscle culture lambda-4.4

PDB Compounds: (A:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOPe Domain Sequences for d2e3va_:

Sequence, based on SEQRES records:

>d2e3va_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
sgpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpvreps

Sequence, based on observed residues (ATOM records):

>d2e3va_ b.1.2.1 (A:) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
sgpsspsidqvepysstaqvqfdepeatvpilkykaewravgeevwhskwydakeasmeg
ivtivglkpettyavrlaalngkglgeisaasefktqpvreps

Timeline for d2e3va_:

• d2e3va_ is new in SCOPe 2.01-stable
  
• d2e3va_ appears in SCOPe 2.02
  
• d2e3va_ appears in the current release, SCOPe 2.08, called d2e3va1