![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141033] (4 PDB entries) Uniprot P13592 498-598 |
![]() | Domain d2e3va1: 2e3v A:10-112 [163808] Other proteins in same PDB: d2e3va2, d2e3vb2, d2e3vc2 automated match to d2haza1 complexed with btb, edo, peg, pge |
PDB Entry: 2e3v (more details), 1.95 Å
SCOPe Domain Sequences for d2e3va1:
Sequence, based on SEQRES records: (download)
>d2e3va1 b.1.2.1 (A:10-112) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} psspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasmeg ivtivglkpettyavrlaalngkglgeisaasefktqpvreps
>d2e3va1 b.1.2.1 (A:10-112) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} psspsidqvepysstaqvqfdepeatvpilkykaewravgeevwhskwydakeasmegiv tivglkpettyavrlaalngkglgeisaasefktqpvreps
Timeline for d2e3va1:
![]() Domains from other chains: (mouse over for more information) d2e3vb1, d2e3vb2, d2e3vc1, d2e3vc2 |