Lineage for d2e18a_ (2e18 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2119957Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2120231Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 2120232Protein automated matches [190116] (24 species)
    not a true protein
  7. 2120314Species Pyrococcus horikoshii OT3 [TaxId:70601] [311263] (4 PDB entries)
  8. 2120319Domain d2e18a_: 2e18 A: [163802]
    automated match to d1xnga1
    complexed with imd, zn

Details for d2e18a_

PDB Entry: 2e18 (more details), 2.1 Å

PDB Description: Crystal structure of project PH0182 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2e18a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e18a_ c.26.2.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mrildydkvierilefirekgnngvvigisggvdsatvaylatkalgkekvlglimpyfe
nkdvedaklvaeklgigykvinikpivdsfvenlelnldrkglgnimsrtrmimlyahan
slgrivlgtsnrsefltgyftkwgdgasdyapiinlyktevweiakrigvperivkkkps
aglwegqtdedelgisynlldeilwrmidlkigkeeiakdlgiplslverveelikkseh
krrlpigpsfedlivg

SCOPe Domain Coordinates for d2e18a_:

Click to download the PDB-style file with coordinates for d2e18a_.
(The format of our PDB-style files is described here.)

Timeline for d2e18a_: