| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:111955] [188207] (1 PDB entry) |
| Domain d2e0qa_: 2e0q A: [163791] automated match to d1nw2a_ |
PDB Entry: 2e0q (more details), 1.49 Å
SCOPe Domain Sequences for d2e0qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e0qa_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
vihldsknfdsflasheiavvdfwaewcapclilapiieelaedypqvgfgklnsdenpd
iaarygvmslptviffkdgepvdeiigavpreeieiriknllge
Timeline for d2e0qa_: