Lineage for d2e0qa_ (2e0q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880371Species Sulfolobus tokodaii [TaxId:111955] [188207] (1 PDB entry)
  8. 2880372Domain d2e0qa_: 2e0q A: [163791]
    automated match to d1nw2a_

Details for d2e0qa_

PDB Entry: 2e0q (more details), 1.49 Å

PDB Description: crystal structure of k53e thioredoxin from sulfolobus tokodaii strain7
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2e0qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0qa_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
vihldsknfdsflasheiavvdfwaewcapclilapiieelaedypqvgfgklnsdenpd
iaarygvmslptviffkdgepvdeiigavpreeieiriknllge

SCOPe Domain Coordinates for d2e0qa_:

Click to download the PDB-style file with coordinates for d2e0qa_.
(The format of our PDB-style files is described here.)

Timeline for d2e0qa_: