Lineage for d2e0mb_ (2e0m B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2535185Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2535186Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2535187Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2535659Protein automated matches [190061] (7 species)
    not a true protein
  7. 2535784Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)
  8. 2535791Domain d2e0mb_: 2e0m B: [163788]
    automated match to d1dzaa_
    complexed with cd, cl; mutant

Details for d2e0mb_

PDB Entry: 2e0m (more details), 1.7 Å

PDB Description: mutant human ribonuclease 1 (t24l, q28l, r31l, r32l)
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2e0mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0mb_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssslycnlmmllrnmtqgrckpvntfvheplvdvqnvcfq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
dasvedst

SCOPe Domain Coordinates for d2e0mb_:

Click to download the PDB-style file with coordinates for d2e0mb_.
(The format of our PDB-style files is described here.)

Timeline for d2e0mb_: