Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein automated matches [190061] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries) |
Domain d2e0mb_: 2e0m B: [163788] automated match to d1dzaa_ complexed with cd, cl; mutant |
PDB Entry: 2e0m (more details), 1.7 Å
SCOPe Domain Sequences for d2e0mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e0mb_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kesrakkfqrqhmdsdsspsssslycnlmmllrnmtqgrckpvntfvheplvdvqnvcfq ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf dasvedst
Timeline for d2e0mb_: