SCOPe 2.01: Domain d2e0ma_: 2e0m A:

Lineage for d2e0ma_ (2e0m A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186903] (4 PDB entries)

8. Domain d2e0ma_: 2e0m A: [163787]
   automated match to d1dzaa_
   complexed with cd, cl; mutant

Details for d2e0ma_

PDB Entry: 2e0m, 1.7 Å

PDB Description: mutant human ribonuclease 1 (t24l, q28l, r31l, r32l)

PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d2e0ma_:

Sequence; same for both SEQRES and ATOM records:

>d2e0ma_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssslycnlmmllrnmtqgrckpvntfvheplvdvqnvcfq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
dasvedst

Timeline for d2e0ma_:

• d2e0ma_ is new in SCOPe 2.01-stable
  
• d2e0ma_ appears in SCOPe 2.02
  
• d2e0ma_ appears in the current release, SCOPe 2.08