Lineage for d2e0jb_ (2e0j B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890050Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1890051Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1890052Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1890445Protein automated matches [190061] (6 species)
    not a true protein
  7. 1890569Species Human (Homo sapiens) [TaxId:9606] [186903] (7 PDB entries)
  8. 1890571Domain d2e0jb_: 2e0j B: [163784]
    automated match to d1dzaa_
    mutant

Details for d2e0jb_

PDB Entry: 2e0j (more details), 1.6 Å

PDB Description: mutant human ribonuclease 1 (r31l, r32l)
PDB Compounds: (B:) Ribonuclease

SCOPe Domain Sequences for d2e0jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e0jb_ d.5.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kesrakkfqrqhmdsdsspsssstycnqmmllrnmtqgrckpvntfvheplvdvqnvcfq
ekvtckngqgncyksnssmhitdcrltngsrypncayrtspkerhiivacegspyvpvhf
dasvedst

SCOPe Domain Coordinates for d2e0jb_:

Click to download the PDB-style file with coordinates for d2e0jb_.
(The format of our PDB-style files is described here.)

Timeline for d2e0jb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2e0ja_