Lineage for d2e07b_ (2e07 B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160460Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2160461Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2160462Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2160467Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2160473Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 2160501Domain d2e07b_: 2e07 B: [163776]
    automated match to d1vcea1
    complexed with gol, mes, sah, so4; mutant

Details for d2e07b_

PDB Entry: 2e07 (more details), 1.9 Å

PDB Description: crystal structure of asp79 to glu mutant of diphthine synthase
PDB Compounds: (B:) Probable diphthine synthase

SCOPe Domain Sequences for d2e07b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e07b_ c.90.1.1 (B:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakenevafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2e07b_:

Click to download the PDB-style file with coordinates for d2e07b_.
(The format of our PDB-style files is described here.)

Timeline for d2e07b_: