SCOPe 2.01: Domain d2e07b_: 2e07 B:

Lineage for d2e07b_ (2e07 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
   Pfam PF00590

6. Protein Diphthine synthase, DphB [102684] (3 species)
   diphthamide biosynthesis methyltransferase

7. Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
   Uniprot O58456 1-265

8. Domain d2e07b_: 2e07 B: [163776]
   automated match to d1vcea1
   complexed with gol, mes, sah, so4; mutant

Details for d2e07b_

PDB Entry: 2e07, 1.9 Å

PDB Description: crystal structure of asp79 to glu mutant of diphthine synthase

PDB Compounds: (B:) Probable diphthine synthase

SCOPe Domain Sequences for d2e07b_:

Sequence; same for both SEQRES and ATOM records:

>d2e07b_ c.90.1.1 (B:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakenevafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

Timeline for d2e07b_:

• d2e07b_ is new in SCOPe 2.01-stable
  
• d2e07b_ appears in SCOPe 2.02
  
• d2e07b_ appears in the current release, SCOPe 2.08