Lineage for d2e00a1 (2e00 A:1-453)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926768Protein Bleomycin hydrolase [54017] (2 species)
    DNA-binding protease that has more insertions in the papain-like fold
  7. 2926769Species Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId:4932] [54018] (9 PDB entries)
  8. 2926772Domain d2e00a1: 2e00 A:1-453 [163771]
    Other proteins in same PDB: d2e00a2
    automated match to d1a6ra_
    mutant

    has additional subdomain(s) that are not in the common domain
    has additional insertions and/or extensions that are not grouped together

Details for d2e00a1

PDB Entry: 2e00 (more details), 2 Å

PDB Description: crystal structure of n392l mutant of yeast bleomycin hydrolase
PDB Compounds: (A:) Cysteine proteinase 1

SCOPe Domain Sequences for d2e00a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e00a1 d.3.1.1 (A:1-453) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]}
msssidiskinswnkefqsdlthqlattvlknynaddallnktrlqkqdnrvfntvvstd
stpvtnqkssgrcwlfaatnqlrlnvlselnlkefelsqaylffydklekanyfldqivs
sadqdidsrlvqyllaaptedggqysmflnlvkkyglipkdlygdlpysttasrkwnsll
ttklrefaetlrtalkersaddsiivtlreqmqreifrlmslfmdippvqpneqftweyv
dkdkkihtikstplefaskyakldpstpvslindprhpygklikidrlgnvlggdaviyl
nvdnetlsklvvkrlqnnkavffgshtpkfmdkktgvmdielwnypaigynlpqqkasri
ryheslmthamlitgchvdetsklplryrvelswgkdsgkdglyvmtqkyfeeycfqivv
dinelpkelaskftsgkeepivlpiwdpmgala

SCOPe Domain Coordinates for d2e00a1:

Click to download the PDB-style file with coordinates for d2e00a1.
(The format of our PDB-style files is described here.)

Timeline for d2e00a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2e00a2