![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein Bleomycin hydrolase [54017] (2 species) DNA-binding protease that has more insertions in the papain-like fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId:4932] [54018] (9 PDB entries) |
![]() | Domain d2dzza1: 2dzz A:1-453 [163770] Other proteins in same PDB: d2dzza2 automated match to d1a6ra_ mutant has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2dzz (more details), 2.15 Å
SCOPe Domain Sequences for d2dzza1:
Sequence, based on SEQRES records: (download)
>d2dzza1 d.3.1.1 (A:1-453) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} msssidiskinswnkefqsdlthqlattvlknynaddallnktrlqkqdnrvfntvvstd stpvtnqkssgrcwlfaatnqlrlnvlselnlkefelsqaylffydklekanyfldqivs sadqdidsrlvqyllaaptedggqysmflnlvkkyglipkdlygdlpysttasrkwnsll ttklrefaetlrtalkersaddsiivtlreqmqreifrlmslfmdippvqpneqftweyv dkdkkihtikstplefaskyakldpstpvslindprhpygklikidrlgnvlggdaviyl nvdnetlsklvvkrlqnnkavffgshtpkfmdkktgvmdielwnypaigynlpqqkasri ryheslmthamlitgchvdetsklplryrvevswgkdsgkdglyvmtqkyfeeycfqivv dinelpkelaskftsgkeepivlpiwdpmgala
>d2dzza1 d.3.1.1 (A:1-453) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} msssidiskinswnkefqsdlthqlattvlknynaddallnktrlqkqdnrvfntvvstd grcwlfaatnqlrlnvlselnlkefelsqaylffydklekanyfldqivssadqdidsrl vqyllaaptedggqysmflnlvkkyglipkdlygdlpysttasrkwnsllttklrefaet lrtalkersaddsiivtlreqmqreifrlmslfmdippvqpneqftweyvdkdkkihtik stplefaskyakldpstpvslindprhpygklikidrlgnvlggdaviylnvdnetlskl vvkrlqnnkavffgshtpkfmdkktgvmdielwnypaigynlpqqkasriryheslmtha mlitgchvdetsklplryrvevswgkdsgkdglyvmtqkyfeeycfqivvdinelpkela skftsgkeepivlpiwdpmgala
Timeline for d2dzza1: