SCOPe 2.07: Domain d1nrea_: 1nre A:

Lineage for d1nrea_ (1nre A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.13: RAP domain-like [47044] (1 superfamily)
   3 helices, the first one is shorter than the other two; bundle, partly opened

4. Superfamily a.13.1: RAP domain-like [47045] (1 family)

5. Family a.13.1.1: RAP domain [47046] (1 protein)

6. Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)

8. Domain d1nrea_: 1nre A: [16377]

Details for d1nrea_

PDB Entry: 1nre

PDB Description: receptor associated protein (rap) domain 1, nmr, minimized average structure

PDB Compounds: (A:) receptor-associated protein

SCOPe Domain Sequences for d1nrea_:

Sequence; same for both SEQRES and ATOM records:

>d1nrea_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdar

Timeline for d1nrea_:

• d1nrea_ first appeared (with stable ids) in SCOP 1.55, called d1nre__
  
• d1nrea_ appears in SCOPe 2.06
  
• d1nrea_ appears in the current release, SCOPe 2.08